PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G24080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 835aa    MW: 91890.5 Da    PI: 6.1685
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G24080.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP111.64.9e-35162237176
                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                   +Cqv+gCead+ e+k yhrrh+vC  +++a++v+++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k
  OB05G24080.1 162 RCQVPGCEADIRELKGYHRRHRVCLRCAHAAAVMLDGVQKRYCQQCGKFHILLDFDEDKRSCRRKLERHNKRRRRK 237
                   6************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-27157224IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.581160237IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-33161240IPR004333Transcription factor, SBP-box
PfamPF031106.8E-27163237IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 835 aa     Download sequence    Send to blast
MPPVPTAGGG GGGAGGEPVW DWGNLLDFAV HEDDSLVLPW DGSIGIEADP TEATLPPAPP  60
PQPAEETEAP EPAPLPSMQP EGSKRRVRKR DPRLVCPNYL AGRVPCACPE IDEMAAALEV  120
EDVATELLAG SRKKTKTAGR GSGAAAGGSG GGTSRGTPAE MRCQVPGCEA DIRELKGYHR  180
RHRVCLRCAH AAAVMLDGVQ KRYCQQCGKF HILLDFDEDK RSCRRKLERH NKRRRRKPDS  240
KGILEKDADD QLDLSADGSG DGELREENID ATTSEMLETV LSNKVLDRET PVGSEDVLSS  300
PTCAQPSLQI DQSKSLVTFA ASIEACLGAK QENTKLTNSP VHDTKSTYAS SCPTGRVSFK  360
LYDWNPAEFP RRLRHQIFEW LSSMPVELEG YIRPGCTILT VYVAMPQHMW DKLSEDTVNL  420
VKSLVNAPNS LLLGKGAFFI HVNNMIFQVL KDGATLTSTR LEVQSPRIHY VHPSWFEAGK  480
PIDLILCGSS LDQPKFRSLV SFDGLYLKHD CCRILSHETF DYVEGGETVL DSQHEIFRIN  540
ITPSKLDNHG PAFVEVENVF GLSNFVPILV GSKHLCSELE RIHDALCGSL DKSSDPCELR  600
GLRQTAMSGF LIDIGWLIRK PSPDEFQNLL SLANIQRWIC MMKFLIQNDF INVLEIIVNS  660
LDNIIGSEVL SNLEKGRLEN HVTEFLGYVS EARNIVDNRP KYDKQTQNDT RWASDNAPNP  720
PMLGTSVPLA EVGTGSSGEH DLRSTNVASG EEENMPLMPK SLPHRQCCHP DINARWLSPA  780
SIGILPGGAM RMRLVTTVVI TAVLCFTACV VLFHPHRVGV LAAPVKRYIS RNYSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A3e-41162242585squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1219237KRSCRRKLERHNKRRRRKP
2223235RRKLERHNKRRRR
3230237NKRRRRKP
4231236KRRRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000570.0AK100057.1 Oryza sativa Japonica Group cDNA clone:J013158B16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015693221.10.0PREDICTED: LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 9
SwissprotQ6I5760.0SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLJ3M7340.0J3M734_ORYBR; Uncharacterized protein
STRINGOB05G24080.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69223344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.11e-150squamosa promoter binding protein-like 7